PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0003s0880.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 284aa    MW: 31229.5 Da    PI: 9.2709
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0003s0880.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-3942102262
                  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             ++++l+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s+
  SapurV1A.0003s0880.1.p  42 PQEQLNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRST 102
                             6899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-234191IPR003851Zinc finger, Dof-type
PfamPF027012.1E-3344100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.19946100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MQSAGPFYLN FHYGKDIKLA KPMEEMSSNT CGRPVLERKA RPQEQLNCPR CNSTNTKFCY  60
YNNYSLTQPR YFCKTCRRYW TEGGSLRNVP VGGGSRKNKR STSSSAASSK LPDLNPPNLS  120
HFSSHNPNRS GHEGQDLNLA FPAMQDSQGI SHYTEVAKAE NNNHNQHSSY SSPYTTSSPI  180
SALELLRSGI ASRDLNSFIP TPMPDSNTLY SSGGFPLQEL KPTLSFSLDG LGSRYGVQQH  240
NGRLLFPFGE HKQLSSTAEA DQNKGQGTSS TGYWNGMFGG GSW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023145.11e-160PREDICTED: dof zinc finger protein DOF3.7-like isoform X2
SwissprotQ433854e-72DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLB9GR411e-144B9GR41_POPTR; DOF AFFECTING GERMINATION 2 family protein
STRINGPOPTR_0002s17490.11e-144(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.48e-67Dof family protein